PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr10P22520_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TALE
Protein Properties Length: 1666aa    MW: 185852 Da    PI: 8.8019
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr10P22520_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox308.8e-10150215391954
                              HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                Homeobox   19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54  
                              Fe   ++yp+  ++++LAk++gLt +qV++WF N R +
  GSMUA_Achr10P22520_001 1502 FEHflHPYPTDVDKQDLAKQTGLTRNQVSNWFINARVR 1539
                              554458******************************88 PP

2BELL1032.2e-3313721438672
                    BELL    6 qkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72  
                                kk+ L+s+l+eV++rYkqy++q+q+vi sFe vagl sa+pY+s+Alka+S+hFrcLk+ i++qi
  GSMUA_Achr10P22520_001 1372 LWKKTSLISMLDEVYRRYKQYYQQMQAVITSFESVAGLSSAAPYASMALKAMSKHFRCLKNIISDQI 1438
                              569**************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1034732.88E-2125243IPR020846Major facilitator superfamily domain
CDDcd061742.17E-431233IPR020846Major facilitator superfamily domain
Gene3DG3DSA:1.20.1250.203.6E-936233No hitNo description
PROSITE patternPS01022089113IPR018456PTR2 family proton/oligopeptide symporter, conserved site
PfamPF008546.6E-91100524IPR000109Proton-dependent oligopeptide transporter family
SuperFamilySSF1034732.88E-21320517IPR020846Major facilitator superfamily domain
CDDcd061748.13E-5332519IPR020846Major facilitator superfamily domain
Gene3DG3DSA:1.20.1250.208.5E-7381535No hitNo description
SuperFamilySSF1034735.1E-18585797IPR020846Major facilitator superfamily domain
Gene3DG3DSA:1.20.1250.207.4E-7608789No hitNo description
PROSITE patternPS010220643667IPR018456PTR2 family proton/oligopeptide symporter, conserved site
PfamPF008544.2E-60654961IPR000109Proton-dependent oligopeptide transporter family
SuperFamilySSF1034735.1E-188751089IPR020846Major facilitator superfamily domain
Gene3DG3DSA:1.20.1250.201.2E-4934949No hitNo description
CDDcd061748.41E-49771086IPR020846Major facilitator superfamily domain
PfamPF008544.5E-119771048IPR000109Proton-dependent oligopeptide transporter family
Gene3DG3DSA:1.20.1250.201.2E-49811090No hitNo description
SMARTSM005741.3E-3513231436IPR006563POX domain
PfamPF075263.4E-3313281435IPR006563POX domain
PROSITE profilePS5007112.3914801543IPR001356Homeobox domain
SMARTSM003899.4E-1114831547IPR001356Homeobox domain
CDDcd000864.80E-1314831544No hitNo description
SuperFamilySSF466893.68E-1614851550IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.9E-2714861547IPR009057Homeodomain-like
PfamPF059207.8E-1815001539IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006857Biological Processoligopeptide transport
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
GO:0005215Molecular Functiontransporter activity
Sequence ? help Back to Top
Protein Sequence    Length: 1666 aa     Download sequence    Send to blast
MEKPQEDAQK WVGDSSVDHK GRVPRRASTG CWKASLFIIV IEFSERLSYF GLATNLIIYL  60
TKVLHEEVKT AAKNVNYWSG VTTMMPLVGG FVADAYLGRF STVVISSLIY IAGLVLLMVS  120
ELVPRLKPCD PSICGRSLRL HEVIFFLAMY LISVGTGGHK PSLESFGADQ FDDNHDEERK  180
KKMSYFNWWN FALCSGLMLG VTMVVYVQDA VGWWLADVVL TAVMCFSLVV FVVGSPFYRY  240
RAPEGSPFKP MLQVVVAAAA KRHLPLPSDA GELYEVPKTQ KSDKRLLCHT NQLRFLDRAA  300
IVEHKYDEAA FAAEKHNSWR LATVTQVEEL KLILSMVPIW LAALPFGICV AQANTFFIKQ  360
GSVMDRQVTN SFKIPPASVY SLSAIGMIVS VTFYDKLLVP FLRKATGNER GISILKRIGI  420
GMAITTVAMI SAALVERKRL RVAVTEQTSV VSMSVFWLLP QFVIMGIGDG FALVGLQEYF  480
YDQVPDGMRS LGIAFYLSVL GAANFLSSLL ITIVDHITSR EGKGSWFAKD LNKSRLDLYY  540
WLIATITVMV EKGRMEKSKD DVQRFVFDSS VDHNGRVPCR TSTGCWKASL FIVAIEFSER  600
LSYFGLATNL IIYLTKVLRQ ELKTAAKNVN YWSGVTTVVP LVGGFIADAY LGRFSTVIIS  660
TLIYIGGLLL LTMSQIVPRL KPCDPVTCGR SLGLHEVIFF LAMYLISLGT GGHKPSLESF  720
GADQFDDNHD EERRKRMSFF NWWNFALCSG LILGVTVVVY VQDRVGWWQA DVALTATMAL  780
SLVSFLAGRP FYRYRKPEGS PFTPMLQVVA AAMAKRHLPL PSDARELCEV PETQTTSKRL  840
LCHTNKLRFL DKAAIIEQKH DEAATAAAGK QNPWRLATVT QVEELKLVLS MVPIWITVLP  900
FGICIAQTNT FFVKQGSVMD RQIGNGFIIP AASIFSLGAL GMVISVTFYE RMLVPILRRV  960
TGDERGRLKV AENEGTIAVS MSVLWLAPQF VIIGVGDGFA LVGLQEYFYD QVPDSMRSLG  1020
IAFYLSVLGV ANFISSVLIT VVDRITSRGG RGSWFAKDVN KSRLDLFYWL LAIMGALNLC  1080
CYVFLARSYS YKKVHQRRVG VIDSSEDDTS SSPRSLSLSL YLPSSEFYKG YCTDRCDPHL  1140
RNSCVTPPHL PPFSVTTKAA VVITSPLASH LNSTRCCGGE LDRRDNPWEE QLLQQQPQMY  1200
YHVPQHSRRE KLRFPQEMSP SHTSFLLLHD HNAATPLYPA GSLTALLPSF CTSFSSSDYS  1260
HNPPISNGVA QFDGHGALPI PSQHQHQIHN QGFSLSLSSS SSPRPTTSRH QVITRTTPLG  1320
PFTGYAAVLN RSRFLDPARK LMEEVCHVGQ QAAIGGGSRE MLLDVDPSRE SLWKKTSLIS  1380
MLDEVYRRYK QYYQQMQAVI TSFESVAGLS SAAPYASMAL KAMSKHFRCL KNIISDQIHH  1440
ANKGIRNEGN SREEISSFGL VDNIGYLQRT TNSTGTFAQP HVWRPQRGLP ERAVSVLRSW  1500
LFEHFLHPYP TDVDKQDLAK QTGLTRNQVS NWFINARVRL WKPMVEEIHS LEMRQKNKVS  1560
AGDHRFLYLM GTKCIDQEEL SPVPVNLVCD GTPNHQHVGG VGNGVSLTLG LHQNNGVCLS  1620
EPLPLSVARR FGLEECSDTY LVTPFGDQER QFGKDVGTRL LHDFVG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4oh3_A1e-1021811135587Nitrate transporter 1.1
4oh3_B1e-1021811135587Nitrate transporter 1.1
5a2n_A1e-1021811135587PROTEIN NRT1/ PTR FAMILY 6.3
5a2n_B1e-1021811135587PROTEIN NRT1/ PTR FAMILY 6.3
5a2o_A1e-1021811135587NITRATE TRANSPORTER 1.1
5a2o_B1e-1021811135587NITRATE TRANSPORTER 1.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009380625.10.0PREDICTED: protein NRT1/ PTR FAMILY 5.7-like isoform X2
SwissprotQ9M3310.0PTR45_ARATH; Protein NRT1/ PTR FAMILY 5.7
TrEMBLM0RKH70.0M0RKH7_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P22520_0010.0(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.13e-66TALE family protein